Lineage for d5vdea_ (5vde A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953870Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2953889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347873] (2 PDB entries)
  8. 2953890Domain d5vdea_: 5vde A: [348064]
    automated match to d1cc7a_
    complexed with cu1

Details for d5vdea_

PDB Entry: 5vde (more details), 1.65 Å

PDB Description: crystal structure of cu(i)-loaded yeast atx1: crystal form i
PDB Compounds: (A:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d5vdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vdea_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekikk
tgkevrsgkql

SCOPe Domain Coordinates for d5vdea_:

Click to download the PDB-style file with coordinates for d5vdea_.
(The format of our PDB-style files is described here.)

Timeline for d5vdea_: