Lineage for d1dwpa1 (1dwp A:2-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901127Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2901128Protein Hydroxynitrile lyase [53586] (2 species)
  7. 2901129Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (10 PDB entries)
  8. 2901144Domain d1dwpa1: 1dwp A:2-258 [34806]
    Other proteins in same PDB: d1dwpa2, d1dwpb2
    complexed with act

Details for d1dwpa1

PDB Entry: 1dwp (more details), 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
PDB Compounds: (A:) hydroxynitrile lyase

SCOPe Domain Sequences for d1dwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwpa1 c.69.1.20 (A:2-258) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
vtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysepl
ltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvekl
lesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslfq
nvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklqlt
kteevahilqevadaya

SCOPe Domain Coordinates for d1dwpa1:

Click to download the PDB-style file with coordinates for d1dwpa1.
(The format of our PDB-style files is described here.)

Timeline for d1dwpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dwpa2