SCOPe 2.07: Domain d5wcza2: 5wcz A:483-561

Lineage for d5wcza2 (5wcz A:483-561)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228101] (5 PDB entries)

8. Domain d5wcza2: 5wcz A:483-561 [348053]
   Other proteins in same PDB: d5wcza1, d5wczb1
   automated match to d4m8ua2
   complexed with gol, noj

Details for d5wcza2

PDB Entry: 5wcz, 1.58 Å

PDB Description: crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin

PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d5wcza2:

Sequence; same for both SEQRES and ATOM records:

>d5wcza2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer
adlksislkpyeavmgisi

Timeline for d5wcza2:

• d5wcza2 is new in SCOPe 2.07-stable
  
• d5wcza2 appears in the current release, SCOPe 2.08