Lineage for d5vwna_ (5vwn A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435297Species Trichomonas vaginalis [TaxId:5722] [195009] (12 PDB entries)
  8. 2435307Domain d5vwna_: 5vwn A: [348051]
    automated match to d4rcxa_
    complexed with na

Details for d5vwna_

PDB Entry: 5vwn (more details), 1.74 Å

PDB Description: triosephosphate isomerases deletion loop 3 from trichomonas vaginalis
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5vwna_:

Sequence, based on SEQRES records: (download)

>d5vwna_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
mrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkdwkv
saenvftkpngtvpmiksfgiewtilghserrdilkeddeflaakakfalengmkiiycc
gehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemc
kvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasleagfinivn
snvhsk

Sequence, based on observed residues (ATOM records): (download)

>d5vwna_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
mrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfvflptlqqklrkdwkv
saenvvpmiksfgiewtilghsddeflaakakfalengmkiiyccgehlsereagkasef
vsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemckvirdilaakvgadi
ankvrilyggsvkpnncnelaacpdvdgflvggasleagfinivnsnvhsk

SCOPe Domain Coordinates for d5vwna_:

Click to download the PDB-style file with coordinates for d5vwna_.
(The format of our PDB-style files is described here.)

Timeline for d5vwna_: