Lineage for d1dwob_ (1dwo B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26945Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 26946Protein Hydroxynitrile lyase [53586] (2 species)
  7. 26947Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (3 PDB entries)
  8. 26949Domain d1dwob_: 1dwo B: [34805]

Details for d1dwob_

PDB Entry: 1dwo (more details), 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis

SCOP Domain Sequences for d1dwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwob_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta)}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOP Domain Coordinates for d1dwob_:

Click to download the PDB-style file with coordinates for d1dwob_.
(The format of our PDB-style files is described here.)

Timeline for d1dwob_: