Lineage for d5yasa_ (5yas A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151980Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2151981Protein Hydroxynitrile lyase [53586] (2 species)
  7. 2152021Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (19 PDB entries)
    Uniprot P52704
  8. 2152039Domain d5yasa_: 5yas A: [34803]
    complexed with fac, so4

Details for d5yasa_

PDB Entry: 5yas (more details), 2.2 Å

PDB Description: hydroxynitrile lyase complexed with hexafluoroacetone
PDB Compounds: (A:) protein (hydroxynitrile lyase)

SCOPe Domain Sequences for d5yasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yasa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOPe Domain Coordinates for d5yasa_:

Click to download the PDB-style file with coordinates for d5yasa_.
(The format of our PDB-style files is described here.)

Timeline for d5yasa_: