Lineage for d5uzra_ (5uzr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723026Species Human (Homo sapiens) [TaxId:9606] [347927] (3 PDB entries)
  8. 2723030Domain d5uzra_: 5uzr A: [348029]
    automated match to d3enja_
    complexed with cl

Details for d5uzra_

PDB Entry: 5uzr (more details), 2.3 Å

PDB Description: crystal structure of citrate synthase from homo sapiens
PDB Compounds: (A:) Citrate synthase, mitochondrial

SCOPe Domain Sequences for d5uzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uzra_ a.103.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldpde
girfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraalps
hvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdliakl
pcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpndpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmsteglmkfvds

SCOPe Domain Coordinates for d5uzra_:

Click to download the PDB-style file with coordinates for d5uzra_.
(The format of our PDB-style files is described here.)

Timeline for d5uzra_: