Lineage for d6yasa_ (6yas A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 401158Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 401159Protein Hydroxynitrile lyase [53586] (2 species)
  7. 401175Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (8 PDB entries)
  8. 401182Domain d6yasa_: 6yas A: [34802]
    complexed with so4

Details for d6yasa_

PDB Entry: 6yas (more details), 2.2 Å

PDB Description: hydroxynitrile lyase from hevea brasiliensis, room temperature structure

SCOP Domain Sequences for d6yasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yasa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis)}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOP Domain Coordinates for d6yasa_:

Click to download the PDB-style file with coordinates for d6yasa_.
(The format of our PDB-style files is described here.)

Timeline for d6yasa_: