SCOPe 2.07: Domain d5vp1a_: 5vp1 A:

Lineage for d5vp1a_ (5vp1 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5vp1a_: 5vp1 A: [348019]
   Other proteins in same PDB: d5vp1b2
   automated match to d5vp0b_
   complexed with 9ga, mg, zn

Details for d5vp1a_

PDB Entry: 5vp1, 1.86 Å

PDB Description: discovery of clinical candidate n-{(1s)-1-[3-fluoro-4- (trifluoromethoxy)phenyl]-2-methoxyethyl}-7-methoxy-2-oxo-2,3- dihydropyrido[2,3-b]pyrazine-4(1h)-carboxamide (tak-915), a highly potent, selective, and brain-penetrating phosphodiesterase 2a inhibitor for the treatment of cognitive disorders

PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5vp1a_:

Sequence; same for both SEQRES and ATOM records:

>d5vp1a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

Timeline for d5vp1a_:

• d5vp1a_ is new in SCOPe 2.07-stable
  
• d5vp1a_ appears in the current release, SCOPe 2.08