Lineage for d5v0xc1 (5v0x C:27-210)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. Domain d5v0xc1: 5v0x C:27-210 [348008]
    Other proteins in same PDB: d5v0xa3, d5v0xb3, d5v0xc3
    automated match to d3iu1a1
    complexed with 8rd, cl, mya, so4

Details for d5v0xc1

PDB Entry: 5v0x (more details), 2.1 Å

PDB Description: crystal structure of glycylpeptide n-tetradecanoyltransferase from plasmodium vivax in complex with inhibitor imp-0001114
PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5v0xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v0xc1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d5v0xc1 are not available.

Timeline for d5v0xc1:

Domains from same chain:
(mouse over for more information)
d5v0xc2, d5v0xc3
Domains from other chains:
(mouse over for more information)
d5v0xa1, d5v0xa2, d5v0xa3, d5v0xb1, d5v0xb2, d5v0xb3