Lineage for d2yasa_ (2yas A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491701Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 491702Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 492216Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 492217Protein Hydroxynitrile lyase [53586] (2 species)
  7. 492233Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (12 PDB entries)
  8. 492235Domain d2yasa_: 2yas A: [34797]

Details for d2yasa_

PDB Entry: 2yas (more details), 1.72 Å

PDB Description: hydroxynitrile lyase from hevea brasiliensis complexed with rhodanide

SCOP Domain Sequences for d2yasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yasa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis)}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOP Domain Coordinates for d2yasa_:

Click to download the PDB-style file with coordinates for d2yasa_.
(The format of our PDB-style files is described here.)

Timeline for d2yasa_: