Lineage for d5vbra1 (5vbr A:29-136)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (14 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 3047907Domain d5vbra1: 5vbr A:29-136 [347969]
    Other proteins in same PDB: d5vbra2, d5vbrb2
    automated match to d2nxba_
    complexed with cl, edo, ibi

Details for d5vbra1

PDB Entry: 5vbr (more details), 1.9 Å

PDB Description: crystal structure of the first bromodomain of human brdt in complex with volasertib
PDB Compounds: (A:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d5vbra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vbra1 a.29.2.0 (A:29-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe

SCOPe Domain Coordinates for d5vbra1:

Click to download the PDB-style file with coordinates for d5vbra1.
(The format of our PDB-style files is described here.)

Timeline for d5vbra1:

  • d5vbra1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5vbra2