Lineage for d1qj4a_ (1qj4 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26945Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 26946Protein Hydroxynitrile lyase [53586] (2 species)
  7. 26954Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (8 PDB entries)
  8. 26955Domain d1qj4a_: 1qj4 A: [34796]

Details for d1qj4a_

PDB Entry: 1qj4 (more details), 1.1 Å

PDB Description: hydroxynitrile-lyase from hevea brasiliensis at atomic resolution

SCOP Domain Sequences for d1qj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj4a_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis)}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
tkeiaeilqevadtyn

SCOP Domain Coordinates for d1qj4a_:

Click to download the PDB-style file with coordinates for d1qj4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qj4a_: