Lineage for d1bu8a2 (1bu8 A:1-336)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26928Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 26929Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
  7. 26943Species Rat (Rattus norvegicus) [TaxId:10116] [53584] (1 PDB entry)
  8. 26944Domain d1bu8a2: 1bu8 A:1-336 [34795]
    Other proteins in same PDB: d1bu8a1

Details for d1bu8a2

PDB Entry: 1bu8 (more details), 1.8 Å

PDB Description: rat pancreatic lipase related protein 2

SCOP Domain Sequences for d1bu8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus)}
kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
cpeegcpkmghyadqfegktatveqtvylntgdsgnft

SCOP Domain Coordinates for d1bu8a2:

Click to download the PDB-style file with coordinates for d1bu8a2.
(The format of our PDB-style files is described here.)

Timeline for d1bu8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bu8a1