SCOPe 2.08: Domain d5ueml2: 5uem L:107-211

Lineage for d5ueml2 (5uem L:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ueml2: 5uem L:107-211 [347937]
   Other proteins in same PDB: d5uemh_, d5ueml1
   automated match to d5gz0a2
   complexed with epe, nag

Details for d5ueml2

PDB Entry: 5uem, 2.7 Å

PDB Description: crystal structure of 354nc37 fab in complex with hiv-1 clade ae strain 93th057 gp120

PDB Compounds: (L:) 354NC37 Fab Light Chain

SCOPe Domain Sequences for d5ueml2:

Sequence; same for both SEQRES and ATOM records:

>d5ueml2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5ueml2:

• d5ueml2 first appeared in SCOPe 2.07