Lineage for d5vanb_ (5van B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3047860Domain d5vanb_: 5van B: [347922]
    automated match to d4heme_
    complexed with bgc, man, mes, nag

Details for d5vanb_

PDB Entry: 5van (more details), 2.2 Å

PDB Description: crystal structure of beta-klotho
PDB Compounds: (B:) Nb914

SCOPe Domain Sequences for d5vanb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vanb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscaasqrtfspyvggwfrqapgkerefvaaiswsggtklya
dsvkgrftisrdnakntvylqmntlkredtavyycaarrinevlttapdydfwgqgtqvt
vs

SCOPe Domain Coordinates for d5vanb_:

Click to download the PDB-style file with coordinates for d5vanb_.
(The format of our PDB-style files is described here.)

Timeline for d5vanb_:

  • d5vanb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06