Lineage for d1lpab2 (1lpa B:1-336)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73967Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 73968Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
  7. 73976Species Human (Homo sapiens) [TaxId:9606] [53581] (2 PDB entries)
  8. 73978Domain d1lpab2: 1lpa B:1-336 [34792]
    Other proteins in same PDB: d1lpaa1, d1lpaa2, d1lpab1

Details for d1lpab2

PDB Entry: 1lpa (more details), 3.04 Å

PDB Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography

SCOP Domain Sequences for d1lpab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpab2 c.69.1.19 (B:1-336) Pancreatic lipase, N-terminal domain {Human (Homo sapiens)}
kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
psggcpqmghyadrypgktndvgqkfyldtgdasnfa

SCOP Domain Coordinates for d1lpab2:

Click to download the PDB-style file with coordinates for d1lpab2.
(The format of our PDB-style files is described here.)

Timeline for d1lpab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpab1