Lineage for d5vf6a2 (5vf6 A:125-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754086Domain d5vf6a2: 5vf6 A:125-243 [347919]
    Other proteins in same PDB: d5vf6a3
    automated match to d4p49a2

Details for d5vf6a2

PDB Entry: 5vf6 (more details), 1.64 Å

PDB Description: crystal structure of single chain variable fragment (scfv45).
PDB Compounds: (A:) single chain variable fragment

SCOPe Domain Sequences for d5vf6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vf6a2 b.1.1.0 (A:125-243) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vtldesggglqapggalslvckasgftfssydmgwirqapgkgleyvagitdngryasyg
savdgratisrdngqssvrlqlnnlraedtgtyycarddgsgwtgnsidawghgteviv

SCOPe Domain Coordinates for d5vf6a2:

Click to download the PDB-style file with coordinates for d5vf6a2.
(The format of our PDB-style files is described here.)

Timeline for d5vf6a2: