![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
![]() | Domain d5vf6a1: 5vf6 A:2-107 [347918] Other proteins in same PDB: d5vf6a3 automated match to d4p49a1 |
PDB Entry: 5vf6 (more details), 1.64 Å
SCOPe Domain Sequences for d5vf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vf6a1 b.1.1.0 (A:2-107) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ltqpssvsanpggtvkitcsgsssaygygwyqqkspgsapvtviynnnkrpsnipsrfsg sksgstgtltitgvqaedeavyfcgsedsstdaifgagttltvlgq
Timeline for d5vf6a1: