Lineage for d1lpbb2 (1lpb B:1-336)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26928Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 26929Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
  7. 26937Species Human (Homo sapiens) [TaxId:9606] [53581] (2 PDB entries)
  8. 26938Domain d1lpbb2: 1lpb B:1-336 [34791]
    Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb1

Details for d1lpbb2

PDB Entry: 1lpb (more details), 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

SCOP Domain Sequences for d1lpbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpbb2 c.69.1.19 (B:1-336) Pancreatic lipase, N-terminal domain {Human (Homo sapiens)}
kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
psggcpqmghyadrypgktndvgqkfyldtgdasnfa

SCOP Domain Coordinates for d1lpbb2:

Click to download the PDB-style file with coordinates for d1lpbb2.
(The format of our PDB-style files is described here.)

Timeline for d1lpbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpbb1