SCOPe 2.07: Domain d1hplb2: 1hpl B:1-336

Lineage for d1hplb2 (1hpl B:1-336)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
   automatically mapped to Pfam PF00151

6. Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
   contains additional, colipase-binding domain

7. Species Horse (Equus caballus) [TaxId:9796] [53579] (1 PDB entry)

8. Domain d1hplb2: 1hpl B:1-336 [34788]
   Other proteins in same PDB: d1hpla1, d1hplb1
   complexed with ca

Details for d1hplb2

PDB Entry: 1hpl, 2.3 Å

PDB Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1hplb2:

Sequence; same for both SEQRES and ATOM records:

>d1hplb2 c.69.1.19 (B:1-336) Pancreatic lipase, N-terminal domain {Horse (Equus caballus) [TaxId: 9796]}
nevcyerlgcfsddspwagiverplkilpwspekvntrfllytnenpdnfqeivadpsti
qssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasq
nvrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpae
pcfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqk
nvlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpc
ssegcpqmghyadrfpgrtkgvgqlfylntgdasnfa

Timeline for d1hplb2:

• d1hplb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hplb2 appears in SCOPe 2.06
  
• d1hplb2 appears in the current release, SCOPe 2.08