Lineage for d1hpla2 (1hpl A:1-336)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901100Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
    automatically mapped to Pfam PF00151
  6. 2901101Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
    contains additional, colipase-binding domain
  7. 2901106Species Horse (Equus caballus) [TaxId:9796] [53579] (1 PDB entry)
  8. 2901107Domain d1hpla2: 1hpl A:1-336 [34787]
    Other proteins in same PDB: d1hpla1, d1hplb1
    complexed with ca

Details for d1hpla2

PDB Entry: 1hpl (more details), 2.3 Å

PDB Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1hpla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpla2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Horse (Equus caballus) [TaxId: 9796]}
nevcyerlgcfsddspwagiverplkilpwspekvntrfllytnenpdnfqeivadpsti
qssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasq
nvrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpae
pcfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqk
nvlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpc
ssegcpqmghyadrfpgrtkgvgqlfylntgdasnfa

SCOPe Domain Coordinates for d1hpla2:

Click to download the PDB-style file with coordinates for d1hpla2.
(The format of our PDB-style files is described here.)

Timeline for d1hpla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hpla1