Lineage for d5v7ka1 (5v7k A:1-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583595Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)
  8. 2583622Domain d5v7ka1: 5v7k A:1-126 [347867]
    automated match to d1plqa1
    mutant

Details for d5v7ka1

PDB Entry: 5v7k (more details), 3.05 Å

PDB Description: pcna mutant d41a/d42a protein defective in gene silencing
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5v7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v7ka1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavaasrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

SCOPe Domain Coordinates for d5v7ka1:

Click to download the PDB-style file with coordinates for d5v7ka1.
(The format of our PDB-style files is described here.)

Timeline for d5v7ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v7ka2