Lineage for d5v48a_ (5v48 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. Protein automated matches [191254] (2 species)
    not a true protein
  7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [317833] (3 PDB entries)
  8. Domain d5v48a_: 5v48 A: [347864]
    automated match to d1r1ha_
    complexed with nag, tio, zn

Details for d5v48a_

PDB Entry: 5v48 (more details), 3 Å

PDB Description: soluble rabbit neprilysin in complex with thiorphan
PDB Compounds: (A:) Neprilysin

SCOPe Domain Sequences for d5v48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v48a_ d.92.1.4 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gickssdciksaarliqnmdataepctdffkyacggwlkrnvipetssrysnfdilrdel
evilkdvlqepktedivavqkaktlyrscvnetaidsrggqpllkllpdvygwpvatqnw
eqtygtswsaeksiaqlnskygkkvlinffvgtddknsmnhiihidqprlglpsrdyyec
tgiykeactayvdfmiavaklirqeeglpidenqisvemnkvmelekeianattksedrn
dpmllynkmtlaqiqnnfsleingkpfswsnftneimstvninipneedvvvyapeylik
lkpiltkysprdlqnlmswrfimdlvsslsrtykdsrnafrkalygttsesatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkkaeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
witgaaivnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsannfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
igqayrayqnyvkkngeekllpgidlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigslqnsvefseafqcpknsymnpekkcrvw

SCOPe Domain Coordinates for d5v48a_ are not available.

Timeline for d5v48a_:

Domains from other chains:
(mouse over for more information)
d5v48b_