Lineage for d1cvla_ (1cvl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135238Family c.69.1.18: Bacterial lipase [53570] (4 protein domains)
    lack the first two strands of the common fold
  6. 2135239Protein Lipase [53571] (4 species)
  7. 2135249Species Chromobacterium viscosum [TaxId:42739] [53576] (1 PDB entry)
  8. 2135250Domain d1cvla_: 1cvl A: [34786]
    complexed with ca

Details for d1cvla_

PDB Entry: 1cvl (more details), 1.6 Å

PDB Description: crystal structure of bacterial lipase from chromobacterium viscosum atcc 6918
PDB Compounds: (A:) triacylglycerol hydrolase

SCOPe Domain Sequences for d1cvla_:

Sequence, based on SEQRES records: (download)

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}
adtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpng
rgeqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefa
dfvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfp
saglgapgscqtgaatetvggsqhllyswggtaiqptstvlgvtgatdtstgtldvanvt
dpstlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrgana
edpvavirthvnrlklqgv

Sequence, based on observed residues (ATOM records): (download)

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}
adtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpng
rgeqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefa
dfvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfp
saglgapgscqtgaatetvggsqhllyswggtaiqptstvtgatdtstgtldvanvtdps
tlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrganaedp
vavirthvnrlklqgv

SCOPe Domain Coordinates for d1cvla_:

Click to download the PDB-style file with coordinates for d1cvla_.
(The format of our PDB-style files is described here.)

Timeline for d1cvla_: