Lineage for d5v39a_ (5v39 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336100Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 3047797Domain d5v39a_: 5v39 A: [347859]
    automated match to d1ie9a_
    complexed with 8vm

Details for d5v39a_

PDB Entry: 5v39 (more details), 2.2 Å

PDB Description: crystal structure of human vitamin d receptor ligand binding domain in complex with a vdrm
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5v39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v39a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
pklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlellqlsmlphlad
lvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgnqd
ykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaali
eaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpecsm
kltplvlevfg

SCOPe Domain Coordinates for d5v39a_:

Click to download the PDB-style file with coordinates for d5v39a_.
(The format of our PDB-style files is described here.)

Timeline for d5v39a_:

  • d5v39a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06