Lineage for d5v5qb_ (5v5q B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein automated matches [190359] (43 species)
    not a true protein
  7. Species Amphitrite ornata [TaxId:129555] [189339] (41 PDB entries)
  8. Domain d5v5qb_: 5v5q B: [347854]
    automated match to d5lkva_
    complexed with gol, hem, oxy, so4; mutant

Details for d5v5qb_

PDB Entry: 5v5q (more details), 1.96 Å

PDB Description: dehaloperoxidase b l9i mutant
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5v5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v5qb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5v5qb_ are not available.

Timeline for d5v5qb_:

Domains from other chains:
(mouse over for more information)
d5v5qa_