Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries) |
Domain d5v7ma2: 5v7m A:127-254 [347852] Other proteins in same PDB: d5v7ma3 automated match to d1plqa2 complexed with mg; mutant |
PDB Entry: 5v7m (more details), 1.93 Å
SCOPe Domain Sequences for d5v7ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v7ma2 d.131.1.2 (A:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} kaeelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkf
Timeline for d5v7ma2: