SCOP 1.73: Domain d1ex9a_: 1ex9 A:

Lineage for d1ex9a_ (1ex9 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (3 proteins)
   lack the first two strands of the common fold

6. Protein Lipase [53571] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53575] (1 PDB entry)

8. Domain d1ex9a_: 1ex9 A: [34785]
   complexed with ca, ocp

Details for d1ex9a_

PDB Entry: 1ex9, 2.54 Å

PDB Description: crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate

PDB Compounds: (A:) lactonizing lipase

SCOP Domain Sequences for d1ex9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}
stytqtkypivlahgmlgfdnilgvdywfgipsalrrdgaqvyvtevsqldtsevrgeql
lqqveeivalsgqpkvnlighshggptiryvaavrpdliasatsvgaphkgsdtadflrq
ippgsageavlsglvnslgalisflssgstgtqnslgsleslnsegaarfnakypqgipt
sacgegaykvngvsyyswsgsspltnfldpsdaflgassltfkngtandglvgtcsshlg
mvirdnyrmnhldevnqvfgltslfetspvsvyrqhanrlknasl

Timeline for d1ex9a_:

• d1ex9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ex9a_ appears in SCOP 1.71
  
• d1ex9a_ appears in SCOP 1.75
  
• d1ex9a_ appears in the current release, SCOPe 2.08