Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) automatically mapped to Pfam PF02507 |
Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
Protein automated matches [236583] (4 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347847] (2 PDB entries) |
Domain d5oy0f_: 5oy0 F: [347848] Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_ automated match to d4kt0f_ complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy0f_ f.23.16.1 (F:) automated matches {Synechocystis sp. [TaxId: 1111708]} addfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrft hagdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwpl aavgeytsgklvmkdseiptspr
Timeline for d5oy0f_: