Lineage for d5ujjb_ (5ujj B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468404Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2468469Species Human (Homo sapiens) [TaxId:9606] [102256] (13 PDB entries)
    Uniprot P23381 94-471
  8. 2468482Domain d5ujjb_: 5ujj B: [347840]
    automated match to d2quia_
    protein/RNA complex; complexed with mg, tym

Details for d5ujjb_

PDB Entry: 5ujj (more details), 2.1 Å

PDB Description: crystal structure of human h130r tryptophanyl-trna synthetase in complex with trpamp
PDB Compounds: (B:) Tryptophan--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d5ujjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujjb_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
dfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphrflrrgiffshrd
mnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekyl
wkdltldqaysyavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnq
vkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrd
vaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrd
tieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpli
aehqarrkevtdeivkefmtprklsfdf

SCOPe Domain Coordinates for d5ujjb_:

Click to download the PDB-style file with coordinates for d5ujjb_.
(The format of our PDB-style files is described here.)

Timeline for d5ujjb_: