Lineage for d5v48b_ (5v48 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529210Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. 2529221Protein automated matches [191254] (2 species)
    not a true protein
  7. 2529225Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [317833] (3 PDB entries)
  8. 3047777Domain d5v48b_: 5v48 B: [347839]
    automated match to d1r1ha_
    complexed with nag, tio, zn

Details for d5v48b_

PDB Entry: 5v48 (more details), 3 Å

PDB Description: soluble rabbit neprilysin in complex with thiorphan
PDB Compounds: (B:) Neprilysin

SCOPe Domain Sequences for d5v48b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v48b_ d.92.1.4 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gickssdciksaarliqnmdataepctdffkyacggwlkrnvipetssrysnfdilrdel
evilkdvlqepktedivavqkaktlyrscvnetaidsrggqpllkllpdvygwpvatqnw
eqtygtswsaeksiaqlnskygkkvlinffvgtddknsmnhiihidqprlglpsrdyyec
tgiykeactayvdfmiavaklirqeeglpidenqisvemnkvmelekeianattksedrn
dpmllynkmtlaqiqnnfsleingkpfswsnftneimstvninipneedvvvyapeylik
lkpiltkysprdlqnlmswrfimdlvsslsrtykdsrnafrkalygttsesatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkkaeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
witgaaivnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsannfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
igqayrayqnyvkkngeekllpgidlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigslqnsvefseafqcpknsymnpekkcrvw

SCOPe Domain Coordinates for d5v48b_:

Click to download the PDB-style file with coordinates for d5v48b_.
(The format of our PDB-style files is described here.)

Timeline for d5v48b_:

  • d5v48b_ is new in SCOPe 2.07-stable