![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins) automatically mapped to Pfam PF02427 |
![]() | Protein automated matches [347347] (3 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [347348] (1 PDB entry) |
![]() | Domain d5oy05_: 5oy0 5: [347826] Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_ automated match to d1gxie_ complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy05_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy05_ b.34.4.2 (5:) automated matches {Synechocystis sp. [TaxId: 1111708]} alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf aenelelvq
Timeline for d5oy05_: