Lineage for d5oy05_ (5oy0 5:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393377Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2393393Protein automated matches [347347] (3 species)
    not a true protein
  7. 2393396Species Synechocystis sp. [TaxId:1111708] [347348] (1 PDB entry)
  8. 2393397Domain d5oy05_: 5oy0 5: [347826]
    Other proteins in same PDB: d5oy00_, d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_, d5oy0l_
    automated match to d1gxie_
    complexed with 45d, act, bcr, c7z, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd

Details for d5oy05_

PDB Entry: 5oy0 (more details), 2.5 Å

PDB Description: structure of synechocystis photosystem i trimer at 2.5a resolution
PDB Compounds: (5:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d5oy05_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oy05_ b.34.4.2 (5:) automated matches {Synechocystis sp. [TaxId: 1111708]}
alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
aenelelvq

SCOPe Domain Coordinates for d5oy05_:

Click to download the PDB-style file with coordinates for d5oy05_.
(The format of our PDB-style files is described here.)

Timeline for d5oy05_: