SCOPe 2.08: Domain d5ubzl1: 5ubz L:1-107

Lineage for d5ubzl1 (5ubz L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ubzl1: 5ubz L:1-107 [347819]
   Other proteins in same PDB: d5ubzh2, d5ubzl2
   automated match to d4m1dl1

Details for d5ubzl1

PDB Entry: 5ubz, 2.75 Å

PDB Description: fab structure of hiv gp120 specific mab 1e12

PDB Compounds: (L:) Anti-HIV1 gp120 mAb 1E12 Fab light chain

SCOPe Domain Sequences for d5ubzl1:

Sequence; same for both SEQRES and ATOM records:

>d5ubzl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qavvtqppsasgtpgqrvtiscsgsssnigsntvnwyqqlpglapklliyssnqrpsgvp
drfsgsksgtsaslaisglqsedeahyycatwddslngvifgggtkltvl

Timeline for d5ubzl1:

• d5ubzl1 first appeared in SCOPe 2.07