Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins) Pfam PF06052; 3-HAO |
Protein automated matches [311561] (3 species) not a true protein |
Species Cupriavidus metallidurans [TaxId:266264] [347812] (11 PDB entries) |
Domain d5v28a_: 5v28 A: [347813] automated match to d4r52a_ complexed with fe2, trs |
PDB Entry: 5v28 (more details), 2.72 Å
SCOPe Domain Sequences for d5v28a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v28a_ b.82.1.20 (A:) automated matches {Cupriavidus metallidurans [TaxId: 266264]} mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy qlrgnaylnlwvdgrreradlkegdifllpphvrhsaqrpeagsaclvierqrpagmldg fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa
Timeline for d5v28a_: