Lineage for d5uz0c1 (5uz0 C:4-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859693Family c.24.1.0: automated matches [347767] (1 protein)
    not a true family
  6. 2859694Protein automated matches [347768] (3 species)
    not a true protein
  7. 2859721Species Human (Homo sapiens) [TaxId:9606] [347769] (2 PDB entries)
  8. 2859724Domain d5uz0c1: 5uz0 C:4-200 [347809]
    Other proteins in same PDB: d5uz0a2, d5uz0b2, d5uz0c2, d5uz0d2
    automated match to d1pkxb1
    complexed with 8us, amz, mg

Details for d5uz0c1

PDB Entry: 5uz0 (more details), 1.79 Å

PDB Description: crystal structure of aicarft bound to an antifolate
PDB Compounds: (C:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d5uz0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uz0c1 c.24.1.0 (C:4-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg
rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq
idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta
qydeaisdyfrkqyskg

SCOPe Domain Coordinates for d5uz0c1:

Click to download the PDB-style file with coordinates for d5uz0c1.
(The format of our PDB-style files is described here.)

Timeline for d5uz0c1: