Lineage for d5uhtb_ (5uht B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464408Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. 2464441Domain d5uhtb_: 5uht B: [347806]
    Other proteins in same PDB: d5uhta1, d5uhta2, d5uhtc1, d5uhtc2
    automated match to d3dgec_
    complexed with adp, gol, mg, so4

Details for d5uhtb_

PDB Entry: 5uht (more details), 2.68 Å

PDB Description: structure of the thermotoga maritima hk853-bef3-rr468 complex at ph 5.0
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5uhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uhtb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
n

SCOPe Domain Coordinates for d5uhtb_:

Click to download the PDB-style file with coordinates for d5uhtb_.
(The format of our PDB-style files is described here.)

Timeline for d5uhtb_: