SCOPe 2.08: Domain d1oila_: 1oil A:

Lineage for d1oila_ (1oil A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase [53571] (4 species)

7. Species Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId:292] [63399] (6 PDB entries)

8. Domain d1oila_: 1oil A: [34780]
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d1oila_

PDB Entry: 1oil, 2.1 Å

PDB Description: structure of lipase

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1oila_:

Sequence; same for both SEQRES and ATOM records:

>d1oila_ c.69.1.18 (A:) Lipase {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]}
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvfgvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv

Timeline for d1oila_:

• d1oila_ first appeared (with stable ids) in SCOP 1.55
  
• d1oila_ appears in SCOPe 2.07