Lineage for d5uxia_ (5uxi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703849Protein automated matches [261918] (5 species)
    not a true protein
  7. 2703855Species Nostoc punctiforme [TaxId:63737] [347765] (1 PDB entry)
  8. 2703856Domain d5uxia_: 5uxi A: [347766]
    automated match to d4z5sa_
    complexed with ddq

Details for d5uxia_

PDB Entry: 5uxi (more details), 2 Å

PDB Description: protein 4 with aldehyde deformylating oxygenase activity from nostoc puntiforme
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d5uxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uxia_ a.25.1.6 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
ldfksetykdaysrinaiviegeqeahenyitlaqllpeshdelirlskmesrhkkgfea
cgrnlavtpdlqfakeffsglhqnfqtaaaegkvvtclliqsliiecfaiaayniyipva
ddfarkitegvvkeeyshlnfgevwlkehfaeskaelelanrqnlpivwkmlnqvegdah
tmamekdalvedfmiqygealsnigfstrdimrlsaygli

SCOPe Domain Coordinates for d5uxia_:

Click to download the PDB-style file with coordinates for d5uxia_.
(The format of our PDB-style files is described here.)

Timeline for d5uxia_: