Lineage for d5u3de1 (5u3d E:21-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934778Species Finegoldia magna [TaxId:1260] [188811] (8 PDB entries)
  8. 2934783Domain d5u3de1: 5u3d E:21-81 [347762]
    Other proteins in same PDB: d5u3da1, d5u3da2, d5u3db_, d5u3dc1, d5u3dc2, d5u3de2
    automated match to d1ymhe_
    complexed with mry

Details for d5u3de1

PDB Entry: 5u3d (more details), 1.77 Å

PDB Description: structure of meditope enabled trastuzumab i83e variant
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d5u3de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u3de1 d.15.7.1 (E:21-81) automated matches {Finegoldia magna [TaxId: 1260]}
vtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikfa
g

SCOPe Domain Coordinates for d5u3de1:

Click to download the PDB-style file with coordinates for d5u3de1.
(The format of our PDB-style files is described here.)

Timeline for d5u3de1:

2934783
d5u3de1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5u3de2