SCOPe 2.07: Domain d5uv8b_: 5uv8 B:

Lineage for d5uv8b_ (5uv8 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries)

8. Domain d5uv8b_: 5uv8 B: [347761]
   automated match to d1jlia_
   complexed with bma, fuc, gol, nag

Details for d5uv8b_

PDB Entry: 5uv8, 2.7 Å

PDB Description: interleukin-3 receptor complex

PDB Compounds: (B:) Interleukin-3

SCOPe Domain Sequences for d5uv8b_:

Sequence, based on SEQRES records:

>d5uv8b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ncsnmideiithlkqpplplldfnnlngedqdilmennlrrpnleafnravkslqnasai
esilknllpclplataaptrhpihikdgdwnefrrkltfylktlena

Sequence, based on observed residues (ATOM records):

>d5uv8b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ncsnmideiithlkqpplldfnnlngedqdilmennlrrpnleafnravkslqnasaies
ilknllpclplataaptrhpihikdgdwnefrrkltfylktlena

Timeline for d5uv8b_:

• d5uv8b_ is new in SCOPe 2.07-stable
  
• d5uv8b_ appears in the current release, SCOPe 2.08