Lineage for d5uv8b_ (5uv8 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2315782Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2315783Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2315881Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2316037Protein automated matches [190501] (4 species)
    not a true protein
  7. 2316038Species Human (Homo sapiens) [TaxId:9606] [187448] (22 PDB entries)
  8. 3047699Domain d5uv8b_: 5uv8 B: [347761]
    automated match to d1jlia_
    complexed with bma, fuc, gol, nag

Details for d5uv8b_

PDB Entry: 5uv8 (more details), 2.7 Å

PDB Description: interleukin-3 receptor complex
PDB Compounds: (B:) Interleukin-3

SCOPe Domain Sequences for d5uv8b_:

Sequence, based on SEQRES records: (download)

>d5uv8b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ncsnmideiithlkqpplplldfnnlngedqdilmennlrrpnleafnravkslqnasai
esilknllpclplataaptrhpihikdgdwnefrrkltfylktlena

Sequence, based on observed residues (ATOM records): (download)

>d5uv8b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ncsnmideiithlkqpplldfnnlngedqdilmennlrrpnleafnravkslqnasaies
ilknllpclplataaptrhpihikdgdwnefrrkltfylktlena

SCOPe Domain Coordinates for d5uv8b_:

Click to download the PDB-style file with coordinates for d5uv8b_.
(The format of our PDB-style files is described here.)

Timeline for d5uv8b_:

  • d5uv8b_ is new in SCOPe 2.07-stable