Lineage for d5ui4b_ (5ui4 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2518282Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2518375Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)
  8. 3047695Domain d5ui4b_: 5ui4 B: [347757]
    automated match to d3l7ua_
    complexed with a7z

Details for d5ui4b_

PDB Entry: 5ui4 (more details), 2.75 Å

PDB Description: structure of nme1 covalently conjugated to imidazole fluorosulfate
PDB Compounds: (B:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d5ui4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui4b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
vesaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d5ui4b_:

Click to download the PDB-style file with coordinates for d5ui4b_.
(The format of our PDB-style files is described here.)

Timeline for d5ui4b_:

  • d5ui4b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06