Lineage for d1taha_ (1tah A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900958Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2900959Protein Lipase [53571] (4 species)
  7. 2900973Species Pseudomonas glumae, also known as Pseudomonas gladioli [TaxId:337] [53572] (2 PDB entries)
  8. 2900975Domain d1taha_: 1tah A: [34775]
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1taha_

PDB Entry: 1tah (more details), 3 Å

PDB Description: the crystal structure of triacylglycerol lipase from pseudomonas glumae reveals a partially redundant catalytic aspartate
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1taha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taha_ c.69.1.18 (A:) Lipase {Pseudomonas glumae, also known as Pseudomonas gladioli [TaxId: 337]}
dtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpngr
geqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefad
fvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfps
aglgapgscqtgaatetvggsqhllyswggtaiqptstvlgvtgatdtstgtldvanvtd
pstlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrganae
dpvavirthvnrlklqgv

SCOPe Domain Coordinates for d1taha_:

Click to download the PDB-style file with coordinates for d1taha_.
(The format of our PDB-style files is described here.)

Timeline for d1taha_: