SCOPe 2.07: Domain d5ujxb_: 5ujx B:

Lineage for d5ujxb_ (5ujx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli [TaxId:562] [53600] (86 PDB entries)

8. Domain d5ujxb_: 5ujx B: [347746]
   automated match to d1ra9a_
   complexed with ca, cl, fol, ipa

Details for d5ujxb_

PDB Entry: 5ujx, 1.8 Å

PDB Description: crystal structure of dhfr in 20% isopropanol

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d5ujxb_:

Sequence; same for both SEQRES and ATOM records:

>d5ujxb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d5ujxb_:

• d5ujxb_ is new in SCOPe 2.07-stable
  
• d5ujxb_ appears in the current release, SCOPe 2.08