![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
![]() | Protein Lipase [53571] (4 species) |
![]() | Species Pseudomonas glumae, also known as Pseudomonas gladioli [TaxId:337] [53572] (2 PDB entries) |
![]() | Domain d1tahb_: 1tah B: [34774] complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1tah (more details), 3 Å
SCOPe Domain Sequences for d1tahb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tahb_ c.69.1.18 (B:) Lipase {Pseudomonas glumae, also known as Pseudomonas gladioli [TaxId: 337]} dtyaatrypvilvhglagtdkfanvvdywygiqsdlqshgakvyvanlsgfqsddgpngr geqllayvkqvlaatgatkvnlighsqggltsryvaavapqlvasvttigtphrgsefad fvqdvlktdptglsstviaafvnvfgtlvssshntdqdalaalrtlttaqtatynrnfps aglgapgscqtgaatetvggsqhllyswggtaiqptstvlgvtgatdtstgtldvanvtd pstlallatgavminrasgqndglvsrcsslfgqvistsyhwnhldeinqllgvrganae dpvavirthvnrlklqgv
Timeline for d1tahb_: