Lineage for d5urib1 (5uri B:67-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857049Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)
  8. 2857077Domain d5urib1: 5uri B:67-235 [347736]
    Other proteins in same PDB: d5uria2, d5uria3, d5urib2, d5urib3
    automated match to d1ja1a2
    complexed with 2am, fad, fmn, po4

Details for d5urib1

PDB Entry: 5uri (more details), 2.7 Å

PDB Description: rat cypor/d632a with 2'-amp
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5urib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5urib1 c.23.5.0 (B:67-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgk
yvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

SCOPe Domain Coordinates for d5urib1:

Click to download the PDB-style file with coordinates for d5urib1.
(The format of our PDB-style files is described here.)

Timeline for d5urib1: