Lineage for d5ueka_ (5uek A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766678Protein automated matches [195145] (3 species)
    not a true protein
  7. 2766683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries)
  8. 2766687Domain d5ueka_: 5uek A: [347735]
    Other proteins in same PDB: d5uekh_, d5uekl1, d5uekl2
    automated match to d2dzea_

Details for d5ueka_

PDB Entry: 5uek (more details), 1.7 Å

PDB Description: structure of antigen-fab 12e complex with histone chaperone asf1
PDB Compounds: (A:) histone chaperone asf1

SCOPe Domain Sequences for d5ueka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ueka_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

SCOPe Domain Coordinates for d5ueka_:

Click to download the PDB-style file with coordinates for d5ueka_.
(The format of our PDB-style files is described here.)

Timeline for d5ueka_: