| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
| Species Escherichia coli [TaxId:562] [53600] (86 PDB entries) |
| Domain d5ujxa_: 5ujx A: [347722] automated match to d1ra9a_ complexed with ca, cl, fol, ipa |
PDB Entry: 5ujx (more details), 1.8 Å
SCOPe Domain Sequences for d5ujxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ujxa_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d5ujxa_: