Lineage for d1clea_ (1cle A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26848Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 26893Protein Type-B carboxylesterase/lipase [53566] (3 species)
  7. 26894Species Candida cylindracea, cholesterol esterase [TaxId:44322] [53569] (1 PDB entry)
  8. 26895Domain d1clea_: 1cle A: [34771]

Details for d1clea_

PDB Entry: 1cle (more details), 2 Å

PDB Description: structure of uncomplexed and linoleate-bound candida cylindracea cholesterol esterase

SCOP Domain Sequences for d1clea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clea_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase}
aptaklangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgslngqkftsygpsc
mqqnpegtfeenlgktaldlvmqskvfqavlpqsedcltinvvrppgtkaganlpvmlwi
fgggfeigsptifppaqmvtksvlmgkpiihvavnyrvaswgflagddikaegsgnaglk
dqrlgmqwvadniagfggdpskvtifgesagsmsvlchliwndgdntykgkplfragimq
sgamvpsdpvdgtygneiydlfvssagcgsasdklaclrsassdtlldatnntpgflays
slrlsylprpdgknitddmyklvrdgkyasvpviigdqndegtvfglsslnvttnaqara
yfkqsfihasdaeidtlmaaypqditqgspfdtgifnaitpqfkrisavlgdlafiharr
yflnhfqggtkysflskqlsglpimgtfhandivwqdyllgsgsviynnafiafatdldp
ntagllvnwpkytsssqsgnnlmminalglytgkdnfrtagydalmtnpssffv

SCOP Domain Coordinates for d1clea_:

Click to download the PDB-style file with coordinates for d1clea_.
(The format of our PDB-style files is described here.)

Timeline for d1clea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cleb_